SETD5,FLJ10707
  • SETD5,FLJ10707

Anti-SETD5 Antibody 25ul

Ref: AN-HPA035574-25ul
Anti-SETD5

Información del producto

Polyclonal Antibody against Human SETD5, Gene description: SET domain containing 5, Alternative Gene Names: FLJ10707, Validated applications: ICC, IHC, Uniprot ID: Q9C0A6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SETD5
Gene Description SET domain containing 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence ETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQ
Immunogen ETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEKLVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10707
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9C0A6
HTS Code 3002150000
Gene ID 55209
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SETD5 Antibody 25ul

Anti-SETD5 Antibody 25ul