AN-HPA035501-100ul
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Size | 100ul |
Gene Name | SGO1 |
Gene Description | shugoshin 1 |
Storage Conditions | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
Shipping Conditions | Normally shipped at ambient temperature |
Species Reactivity Cross | Human |
Applications | ICC |
Sequence | DFETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANRRKSKRMSK |
Immunogen | DFETSHLAGKSFEFERVGFLDPLVNMHIPENVQHNACQWSKDQVNLSPKLIQPGTFTKTKEDILESKSEQTKSKQRDTQERKREEKRKANRRKSKRMSK |
Storage Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Product Group | Polyclonal Antibodies |
Alternative Names | NY-BR-85, SGOL1 |
Category | Polyclonal |
Isoelectric Point | IgG |
Host | RABBIT |
UniProt ID | Q5FBB7 |
HTS Code | 3002150000 |
Gene ID | 151648 |
Buffer Formulation | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Purification | Affinity purified using the PrEST antigen as affinity ligand |
Iso type | IgG |
Aplicativo | ICC |
Conjugation | Unconjugated |