HACL1,2-HPCL,HPCL
  • HACL1,2-HPCL,HPCL

Anti-HACL1 Antibody 100ul

Ref: AN-HPA035497-100ul
Anti-HACL1

Información del producto

Polyclonal Antibody against Human HACL1, Gene description: 2-hydroxyacyl-CoA lyase 1, Alternative Gene Names: 2-HPCL, HPCL, PHYH2, Validated applications: IHC, Uniprot ID: Q9UJ83, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HACL1
Gene Description 2-hydroxyacyl-CoA lyase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPISMAETSAVCTAASVIRNAKQPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVV
Immunogen YGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPISMAETSAVCTAASVIRNAKQPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2-HPCL, HPCL, PHYH2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UJ83
HTS Code 3002150000
Gene ID 26061
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HACL1 Antibody 100ul

Anti-HACL1 Antibody 100ul