MRPS18A,FLJ10548
  • MRPS18A,FLJ10548

Anti-MRPS18A Antibody 100ul

Ref: AN-HPA035451-100ul
Anti-MRPS18A

Información del producto

Polyclonal Antibody against Human MRPS18A, Gene description: mitochondrial ribosomal protein S18A, Alternative Gene Names: FLJ10548, MRPS18-3, Validated applications: IHC, WB, Uniprot ID: Q9NVS2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPS18A
Gene Description mitochondrial ribosomal protein S18A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence PSELQRELQRLSPLPRHSGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH
Immunogen PSELQRELQRLSPLPRHSGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10548, MRPS18-3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NVS2
HTS Code 3002150000
Gene ID 55168
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MRPS18A Antibody 100ul

Anti-MRPS18A Antibody 100ul