SOGA3,C6orf174
  • SOGA3,C6orf174

Anti-SOGA3 Antibody 25ul

Ref: AN-HPA035389-25ul
Anti-SOGA3

Información del producto

Polyclonal Antibody against Human SOGA3, Gene description: SOGA family member 3, Alternative Gene Names: C6orf174, dJ403A15.3, Validated applications: IHC, WB, Uniprot ID: Q5TF21, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SOGA3
Gene Description SOGA family member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence GWRGKGVRAQQRGGSGGEGASPSPSSSSAGKTPGTGSRNSGSGVAGGGSGGGGSYWKEGCLQSELIQFHLKKER
Immunogen GWRGKGVRAQQRGGSGGEGASPSPSSSSAGKTPGTGSRNSGSGVAGGGSGGGGSYWKEGCLQSELIQFHLKKER
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf174, dJ403A15.3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5TF21
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SOGA3 Antibody 25ul

Anti-SOGA3 Antibody 25ul