NDUFAF3,2P1,C3orf60
  • NDUFAF3,2P1,C3orf60

Anti-NDUFAF3 Antibody 100ul

Ref: AN-HPA035377-100ul
Anti-NDUFAF3

Información del producto

Polyclonal Antibody against Human NDUFAF3, Gene description: NADH dehydrogenase (ubiquinone) complex I, assembly factor 3, Alternative Gene Names: 2P1, C3orf60, DKFZP564J0123, E3-3, MGC10527, Validated applications: IHC, WB, Uniprot ID: Q9BU61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFAF3
Gene Description NADH dehydrogenase (ubiquinone) complex I, assembly factor 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC
Sequence LLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ
Immunogen LLEPRIEIVVVGTGDRTERLQSQVLQAMRQRGIAVEVQDTPNACATFNFLCHEGRVTGAALIPPPGGTSLTSLGQAAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 2P1, C3orf60, DKFZP564J0123, E3-3, MGC10527
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BU61
HTS Code 3002150000
Gene ID 25915
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-NDUFAF3 Antibody 100ul

Anti-NDUFAF3 Antibody 100ul