UBASH3A,CLIP4,STS-2
  • UBASH3A,CLIP4,STS-2

Anti-UBASH3A Antibody 100ul

Ref: AN-HPA035367-100ul
Anti-UBASH3A

Información del producto

Polyclonal Antibody against Human UBASH3A, Gene description: ubiquitin associated and SH3 domain containing A, Alternative Gene Names: CLIP4, STS-2, TULA, Validated applications: ICC, Uniprot ID: P57075, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name UBASH3A
Gene Description ubiquitin associated and SH3 domain containing A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY
Immunogen LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLIP4, STS-2, TULA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P57075
HTS Code 3002150000
Gene ID 53347
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-UBASH3A Antibody 100ul

Anti-UBASH3A Antibody 100ul