SLC5A11,KST1,SGLT6
  • SLC5A11,KST1,SGLT6

Anti-SLC5A11 Antibody 25ul

Ref: AN-HPA035331-25ul
Anti-SLC5A11

Información del producto

Polyclonal Antibody against Human SLC5A11, Gene description: solute carrier family 5 (sodium/inositol cotransporter), member 11, Alternative Gene Names: KST1, SGLT6, SMIT2, Validated applications: ICC, IHC, Uniprot ID: Q8WWX8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SLC5A11
Gene Description solute carrier family 5 (sodium/inositol cotransporter), member 11
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence EPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGK
Immunogen EPPSKEMVSHLTWFTRHDPVVQKEQAPPAAPLSLTLSQNGMPEASSSSSVQFEMVQENTSKTHSCDMTPKQSKVVKAILWLCGIQEKGK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KST1, SGLT6, SMIT2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WWX8
HTS Code 3002150000
Gene ID 115584
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SLC5A11 Antibody 25ul

Anti-SLC5A11 Antibody 25ul