ZBTB3,FLJ23392
  • ZBTB3,FLJ23392

Anti-ZBTB3 Antibody 25ul

Ref: AN-HPA035322-25ul
Anti-ZBTB3

Información del producto

Polyclonal Antibody against Human ZBTB3, Gene description: zinc finger and BTB domain containing 3, Alternative Gene Names: FLJ23392, Validated applications: IHC, Uniprot ID: Q9H5J0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ZBTB3
Gene Description zinc finger and BTB domain containing 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence PVSAPVPSQAPAPAEAELVQVKVEAIVISDEETDVSDEQPQGPERAFPSGGAVYGAQPSQPEAFEDPGAA
Immunogen PVSAPVPSQAPAPAEAELVQVKVEAIVISDEETDVSDEQPQGPERAFPSGGAVYGAQPSQPEAFEDPGAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ23392
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H5J0
HTS Code 3002150000
Gene ID 79842
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZBTB3 Antibody 25ul

Anti-ZBTB3 Antibody 25ul