IL1RAP,C3orf13
  • IL1RAP,C3orf13

Anti-IL1RAP Antibody 100ul

Ref: AN-HPA035293-100ul
Anti-IL1RAP

Información del producto

Polyclonal Antibody against Human IL1RAP, Gene description: interleukin 1 receptor accessory protein, Alternative Gene Names: C3orf13, IL-1RAcP, IL1R3, Validated applications: IHC, Uniprot ID: Q9NPH3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name IL1RAP
Gene Description interleukin 1 receptor accessory protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF
Immunogen CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C3orf13, IL-1RAcP, IL1R3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NPH3
HTS Code 3002150000
Gene ID 3556
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-IL1RAP Antibody 100ul

Anti-IL1RAP Antibody 100ul