GORASP2,GOLPH6
  • GORASP2,GOLPH6

Anti-GORASP2 Antibody 25ul

Ref: AN-HPA035275-25ul
Anti-GORASP2

Información del producto

Polyclonal Antibody against Human GORASP2, Gene description: golgi reassembly stacking protein 2, 55kDa, Alternative Gene Names: GOLPH6, GRASP55, GRS2, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H8Y8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GORASP2
Gene Description golgi reassembly stacking protein 2, 55kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB, IHC, ICC
Sequence PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
Immunogen PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GOLPH6, GRASP55, GRS2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H8Y8
HTS Code 3002150000
Gene ID 26003
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GORASP2 Antibody 25ul

Anti-GORASP2 Antibody 25ul