CBLC,CBL-3,CBL-SL
  • CBLC,CBL-3,CBL-SL

Anti-CBLC Antibody 100ul

Ref: AN-HPA035266-100ul
Anti-CBLC

Información del producto

Polyclonal Antibody against Human CBLC, Gene description: Cbl proto-oncogene C, E3 ubiquitin protein ligase, Alternative Gene Names: CBL-3, CBL-SL, RNF57, Validated applications: ICC, Uniprot ID: Q9ULV8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CBLC
Gene Description Cbl proto-oncogene C, E3 ubiquitin protein ligase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL
Immunogen GRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGPGGPGGSGDFLLIYL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CBL-3, CBL-SL, RNF57
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9ULV8
HTS Code 3002150000
Gene ID 23624
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CBLC Antibody 100ul

Anti-CBLC Antibody 100ul