ZRANB3,DKFZP434B1727
  • ZRANB3,DKFZP434B1727

Anti-ZRANB3 Antibody 100ul

Ref: AN-HPA035234-100ul
Anti-ZRANB3

Información del producto

Polyclonal Antibody against Human ZRANB3, Gene description: zinc finger, RAN-binding domain containing 3, Alternative Gene Names: DKFZP434B1727, Validated applications: ICC, Uniprot ID: Q5FWF4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZRANB3
Gene Description zinc finger, RAN-binding domain containing 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence AVDNEGNPLCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLRDAPKSQRKNLLYATWT
Immunogen AVDNEGNPLCLRCQQPTCQTKQACKANSWDSRFCSLKCQEEFWIRSNNSYLRAKVFETEHGVCQLCNVNAQELFLRLRDAPKSQRKNLLYATWT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434B1727
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5FWF4
HTS Code 3002150000
Gene ID 84083
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZRANB3 Antibody 100ul

Anti-ZRANB3 Antibody 100ul