MBNL1,EXP,EXP35
  • MBNL1,EXP,EXP35

Anti-MBNL1 Antibody 100ul

Ref: AN-HPA035098-100ul
Anti-MBNL1

Información del producto

Polyclonal Antibody against Human MBNL1, Gene description: muscleblind-like splicing regulator 1, Alternative Gene Names: EXP, EXP35, EXP40, EXP42, KIAA0428, MBNL, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NR56, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MBNL1
Gene Description muscleblind-like splicing regulator 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence KNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPA
Immunogen KNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EXP, EXP35, EXP40, EXP42, KIAA0428, MBNL
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NR56
HTS Code 3002150000
Gene ID 4154
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MBNL1 Antibody 100ul

Anti-MBNL1 Antibody 100ul