GPR152,PGR5
  • GPR152,PGR5

Anti-GPR152 Antibody 100ul

Ref: AN-HPA035078-100ul
Anti-GPR152

Información del producto

Polyclonal Antibody against Human GPR152, Gene description: G protein-coupled receptor 152, Alternative Gene Names: PGR5, Validated applications: IHC, Uniprot ID: Q8TDT2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GPR152
Gene Description G protein-coupled receptor 152
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ
Immunogen DLRTLLRSVLSSFAAALCEERPGSFTPTEPQTQLDSEGPTLPEPMAEAQSQMDPVAQPQVNPTLQPRSDPTAQPQLNPTAQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PGR5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TDT2
HTS Code 3002150000
Gene ID 390212
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GPR152 Antibody 100ul

Anti-GPR152 Antibody 100ul