HS1BP3,FLJ14249
  • HS1BP3,FLJ14249

Anti-HS1BP3 Antibody 25ul

Ref: AN-HPA035050-25ul
Anti-HS1BP3

Información del producto

Polyclonal Antibody against Human HS1BP3, Gene description: HCLS1 binding protein 3, Alternative Gene Names: FLJ14249, HS1-BP3, Validated applications: ICC, IHC, Uniprot ID: Q53T59, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HS1BP3
Gene Description HCLS1 binding protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAE
Immunogen LFVGESDIRERRAVFNEILRCVSKDAELAGSPELLEFLGTRSPGAAGLTSRDSSVLDGTDSQTGNDEEAFDFFEEQDQVAE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14249, HS1-BP3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q53T59
HTS Code 3002150000
Gene ID 64342
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HS1BP3 Antibody 25ul

Anti-HS1BP3 Antibody 25ul