KLHL18,FLJ13703
  • KLHL18,FLJ13703

Anti-KLHL18 Antibody 100ul

Ref: AN-HPA035028-100ul
Anti-KLHL18

Información del producto

Polyclonal Antibody against Human KLHL18, Gene description: kelch-like family member 18, Alternative Gene Names: FLJ13703, KIAA0795, Validated applications: ICC, IHC, Uniprot ID: O94889, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KLHL18
Gene Description kelch-like family member 18
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHT
Immunogen SAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMFVCGGYDGSGFLSIAEMYSSVADQWCLIVPMHT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13703, KIAA0795
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94889
HTS Code 3002150000
Gene ID 23276
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KLHL18 Antibody 100ul

Anti-KLHL18 Antibody 100ul