STK17B,DRAK2
  • STK17B,DRAK2

Anti-STK17B Antibody 100ul

Ref: AN-HPA034858-100ul
Anti-STK17B

Información del producto

Polyclonal Antibody against Human STK17B, Gene description: serine/threonine kinase 17b, Alternative Gene Names: DRAK2, Validated applications: IHC, WB, Uniprot ID: O94768, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STK17B
Gene Description serine/threonine kinase 17b
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLL
Immunogen ICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DRAK2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O94768
HTS Code 3002150000
Gene ID 9262
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STK17B Antibody 100ul

Anti-STK17B Antibody 100ul