YBX3,CSDA,CSDA1
  • YBX3,CSDA,CSDA1

Anti-YBX3 Antibody 25ul

Ref: AN-HPA034838-25ul
Anti-YBX3

Información del producto

Polyclonal Antibody against Human YBX3, Gene description: Y box binding protein 3, Alternative Gene Names: CSDA, CSDA1, dbpA, ZONAB, Validated applications: ICC, IHC, Uniprot ID: P16989, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name YBX3
Gene Description Y box binding protein 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence GSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPT
Immunogen GSSEGFDPPATDRQFSGARNQLRRPQYRPQYRQRRFPPYHVGQTFDRRSRVLPHPNRIQAGEIGEMKDGVPEGAQLQGPVHRNPT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CSDA, CSDA1, dbpA, ZONAB
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P16989
HTS Code 3002150000
Gene ID 8531
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-YBX3 Antibody 25ul

Anti-YBX3 Antibody 25ul