SF3B6,CGI-110,Ht006
  • SF3B6,CGI-110,Ht006

Anti-SF3B6 Antibody 100ul

Ref: AN-HPA034829-100ul
Anti-SF3B6

Información del producto

Polyclonal Antibody against Human SF3B6, Gene description: splicing factor 3b, subunit 6, 14kDa, Alternative Gene Names: CGI-110, Ht006, P14, SAP14a, SF3B14a, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y3B4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SF3B6
Gene Description splicing factor 3b, subunit 6, 14kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP
Immunogen YEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-110, Ht006, P14, SAP14a, SF3B14a
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3B4
HTS Code 3002150000
Gene ID 51639
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SF3B6 Antibody 100ul

Anti-SF3B6 Antibody 100ul