TRAPPC12,CGI-87
  • TRAPPC12,CGI-87

Anti-TRAPPC12 Antibody 25ul

Ref: AN-HPA034799-25ul
Anti-TRAPPC12

Información del producto

Polyclonal Antibody against Human TRAPPC12, Gene description: trafficking protein particle complex 12, Alternative Gene Names: CGI-87, TTC-15, TTC15, Validated applications: IHC, WB, Uniprot ID: Q8WVT3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TRAPPC12
Gene Description trafficking protein particle complex 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence AFLHLGQNNFAEAHRFFTEILRMDPRNAVANNNAAVCLLYLGKLKDSLRQLEAMVQQDPRHYLHESVLFNLTTMYELESSRSMQKKQ
Immunogen AFLHLGQNNFAEAHRFFTEILRMDPRNAVANNNAAVCLLYLGKLKDSLRQLEAMVQQDPRHYLHESVLFNLTTMYELESSRSMQKKQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-87, TTC-15, TTC15
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVT3
HTS Code 3002150000
Gene ID 51112
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TRAPPC12 Antibody 25ul

Anti-TRAPPC12 Antibody 25ul