RNF219,C13orf7
  • RNF219,C13orf7

Anti-RNF219 Antibody 25ul

Ref: AN-HPA034785-25ul
Anti-RNF219

Información del producto

Polyclonal Antibody against Human RNF219, Gene description: ring finger protein 219, Alternative Gene Names: C13orf7, FLJ13449, Validated applications: ICC, IHC, Uniprot ID: Q5W0B1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RNF219
Gene Description ring finger protein 219
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SKGSLTNDQLENGSEWKPTSFFLLSPSDQEMNEDFSLHSSSCPVTNEIKPPSCLFQTEFSQGILLSSSHRLFEDQRFGSSLFK
Immunogen SKGSLTNDQLENGSEWKPTSFFLLSPSDQEMNEDFSLHSSSCPVTNEIKPPSCLFQTEFSQGILLSSSHRLFEDQRFGSSLFK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C13orf7, FLJ13449
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5W0B1
HTS Code 3002150000
Gene ID 79596
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RNF219 Antibody 25ul

Anti-RNF219 Antibody 25ul