HEMK1,MTQ1
  • HEMK1,MTQ1

Anti-HEMK1 Antibody 25ul

Ref: AN-HPA034702-25ul
Anti-HEMK1

Información del producto

Polyclonal Antibody against Human HEMK1, Gene description: HemK methyltransferase family member 1, Alternative Gene Names: MTQ1, Validated applications: IHC, WB, Uniprot ID: Q9Y5R4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HEMK1
Gene Description HemK methyltransferase family member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence VSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILALAPRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCG
Immunogen VSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILALAPRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MTQ1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y5R4
HTS Code 3002150000
Gene ID 51409
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HEMK1 Antibody 25ul

Anti-HEMK1 Antibody 25ul