TXNDC5,EndoPDI
  • TXNDC5,EndoPDI

Anti-TXNDC5 Antibody 25ul

Ref: AN-HPA034678-25ul
Anti-TXNDC5

Información del producto

Polyclonal Antibody against Human TXNDC5, Gene description: thioredoxin domain containing 5 (endoplasmic reticulum), Alternative Gene Names: EndoPDI, ERp46, FLJ21353, FLJ90810, Hcc-2, MGC3178, PDIA15, Validated applications: ICC, IHC, WB, Uniprot ID: Q8NBS9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TXNDC5
Gene Description thioredoxin domain containing 5 (endoplasmic reticulum)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence TQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFD
Immunogen TQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names EndoPDI, ERp46, FLJ21353, FLJ90810, Hcc-2, MGC3178, PDIA15
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NBS9
HTS Code 3002150000
Gene ID 81567
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TXNDC5 Antibody 25ul

Anti-TXNDC5 Antibody 25ul