CPSF3,CPSF-73
  • CPSF3,CPSF-73

Anti-CPSF3 Antibody 25ul

Ref: AN-HPA034657-25ul
Anti-CPSF3

Información del producto

Polyclonal Antibody against Human CPSF3, Gene description: cleavage and polyadenylation specific factor 3, 73kDa, Alternative Gene Names: CPSF-73, CPSF73, YSH1, Validated applications: IHC, WB, Uniprot ID: Q9UKF6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CPSF3
Gene Description cleavage and polyadenylation specific factor 3, 73kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence PFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
Immunogen PFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CPSF-73, CPSF73, YSH1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UKF6
HTS Code 3002150000
Gene ID 51692
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CPSF3 Antibody 25ul

Anti-CPSF3 Antibody 25ul