HECW2,KIAA1301,NEDL2
  • HECW2,KIAA1301,NEDL2

Anti-HECW2 Antibody 25ul

Ref: AN-HPA034609-25ul
Anti-HECW2

Información del producto

Polyclonal Antibody against Human HECW2, Gene description: HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2, Alternative Gene Names: KIAA1301, NEDL2, Validated applications: ICC, IHC, Uniprot ID: Q9P2P5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HECW2
Gene Description HECT, C2 and WW domain containing E3 ubiquitin protein ligase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence TATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPSSLEEEGGLIMFSRASRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLP
Immunogen TATCSERSMGASPKLRSSFPTDTRLNAMLHIDSDEEDHEFQQDLGYPSSLEEEGGLIMFSRASRADDGSLTSQTKLEDNPVENEEASTHEAASFEDKPENLP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA1301, NEDL2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2P5
HTS Code 3002150000
Gene ID 57520
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HECW2 Antibody 25ul

Anti-HECW2 Antibody 25ul