PPEF1,PPEF,PPP7CA
  • PPEF1,PPEF,PPP7CA

Anti-PPEF1 Antibody 100ul

Ref: AN-HPA034577-100ul
Anti-PPEF1

Información del producto

Polyclonal Antibody against Human PPEF1, Gene description: protein phosphatase, EF-hand calcium binding domain 1, Alternative Gene Names: PPEF, PPP7CA, Validated applications: IHC, Uniprot ID: O14829, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PPEF1
Gene Description protein phosphatase, EF-hand calcium binding domain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDP
Immunogen ILVIHGGISETTDLNLLHRVERNKMKSVLIPPTETNRDHDTDSKHNKVGVTFNAHGRIKTNGSPTEHLTEHEWEQIIDILWSDP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PPEF, PPP7CA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14829
HTS Code 3002150000
Gene ID 5475
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PPEF1 Antibody 100ul

Anti-PPEF1 Antibody 100ul