SNRNP27,RY1
  • SNRNP27,RY1

Anti-SNRNP27 Antibody 100ul

Ref: AN-HPA034541-100ul
Anti-SNRNP27

Información del producto

Polyclonal Antibody against Human SNRNP27, Gene description: small nuclear ribonucleoprotein 27kDa (U4/U6.U5), Alternative Gene Names: RY1, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WVK2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SNRNP27
Gene Description small nuclear ribonucleoprotein 27kDa (U4/U6.U5)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence TSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNR
Immunogen TSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names RY1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVK2
HTS Code 3002150000
Gene ID 11017
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SNRNP27 Antibody 100ul

Anti-SNRNP27 Antibody 100ul