MSL3,MSL3L1
  • MSL3,MSL3L1

Anti-MSL3 Antibody 100ul

Ref: AN-HPA034535-100ul
Anti-MSL3

Información del producto

Polyclonal Antibody against Human MSL3, Gene description: male-specific lethal 3 homolog (Drosophila), Alternative Gene Names: MSL3L1, Validated applications: IHC, WB, Uniprot ID: Q8N5Y2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MSL3
Gene Description male-specific lethal 3 homolog (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence NPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRRSTRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAV
Immunogen NPSTPQSTESQPTTGEPATPKRRKAEPEALQSLRRSTRHSANCDRLSESSASPQPKRRQQDTSASMPKLFLHLEKKTPVHSRSSSPIPLTPSKEGSAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MSL3L1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8N5Y2
HTS Code 3002150000
Gene ID 10943
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MSL3 Antibody 100ul

Anti-MSL3 Antibody 100ul