DDIT4,Dig2,FLJ20500
  • DDIT4,Dig2,FLJ20500

Anti-DDIT4 Antibody 100ul

Ref: AN-HPA034508-100ul
Anti-DDIT4

Información del producto

Polyclonal Antibody against Human DDIT4, Gene description: DNA-damage-inducible transcript 4, Alternative Gene Names: Dig2, FLJ20500, REDD-1, REDD1, RTP801, Validated applications: ICC, IHC, Uniprot ID: Q9NX09, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DDIT4
Gene Description DNA-damage-inducible transcript 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence QLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALD
Immunogen QLLQESLAQARLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVGQLALD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Dig2, FLJ20500, REDD-1, REDD1, RTP801
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NX09
HTS Code 3002150000
Gene ID 54541
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DDIT4 Antibody 100ul

Anti-DDIT4 Antibody 100ul