MAPK1IP1L,C14orf32
  • MAPK1IP1L,C14orf32

Anti-MAPK1IP1L Antibody 100ul

Ref: AN-HPA034506-100ul
Anti-MAPK1IP1L

Información del producto

Polyclonal Antibody against Human MAPK1IP1L, Gene description: mitogen-activated protein kinase 1 interacting protein 1-like, Alternative Gene Names: C14orf32, Validated applications: ICC, IHC, Uniprot ID: Q8NDC0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAPK1IP1L
Gene Description mitogen-activated protein kinase 1 interacting protein 1-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG
Immunogen APPVPWGTVPPGAWGPPAPYPAPTGSYPTPGLYPTPSNPFQVPSGPSGAPPMPGG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf32
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NDC0
HTS Code 3002150000
Gene ID 93487
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MAPK1IP1L Antibody 100ul

Anti-MAPK1IP1L Antibody 100ul