ABHD13,bA153I24.2
  • ABHD13,bA153I24.2

Anti-ABHD13 Antibody 25ul

Ref: AN-HPA032143-25ul
Anti-ABHD13

Información del producto

Polyclonal Antibody against Human ABHD13, Gene description: abhydrolase domain containing 13, Alternative Gene Names: bA153I24.2, BEM46L1, C13orf6, FLJ14906, Validated applications: ICC, IHC, WB, Uniprot ID: Q7L211, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ABHD13
Gene Description abhydrolase domain containing 13
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence MRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVK
Immunogen MRYLPLWCYKNKFLSYRKISQCRMPSLFISGLSDQLIPPVMMKQLYELSPSRTKRLAIFPDGTHNDTWQCQGYFTALEQFIKEVVK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA153I24.2, BEM46L1, C13orf6, FLJ14906
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q7L211
HTS Code 3002150000
Gene ID 84945
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ABHD13 Antibody 25ul

Anti-ABHD13 Antibody 25ul