CLCN6,CLC-6,KIAA0046
  • CLCN6,CLC-6,KIAA0046

Anti-CLCN6 Antibody 25ul

Ref: AN-HPA032097-25ul
Anti-CLCN6

Información del producto

Polyclonal Antibody against Human CLCN6, Gene description: chloride channel, voltage-sensitive 6, Alternative Gene Names: CLC-6, KIAA0046, Validated applications: IHC, Uniprot ID: P51797, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CLCN6
Gene Description chloride channel, voltage-sensitive 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KGIYDIHVGLRGVPLLEWETEVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFKKSSILT
Immunogen KGIYDIHVGLRGVPLLEWETEVEMDKLRASDIMEPNLTYVYPHTRIQSLVSILRTTVHHAFPVVTENRGNEKEFMKGNQLISNNIKFKKSSILT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLC-6, KIAA0046
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51797
HTS Code 3002150000
Gene ID 1185
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLCN6 Antibody 25ul

Anti-CLCN6 Antibody 25ul