SF3A3,PRP9,PRPF9
  • SF3A3,PRP9,PRPF9

Anti-SF3A3 Antibody 100ul

Ref: AN-HPA032055-100ul
Anti-SF3A3

Información del producto

Polyclonal Antibody against Human SF3A3, Gene description: splicing factor 3a, subunit 3, 60kDa, Alternative Gene Names: PRP9, PRPF9, SAP61, SF3a60, Validated applications: IHC, WB, Uniprot ID: Q12874, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SF3A3
Gene Description splicing factor 3a, subunit 3, 60kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence LGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQK
Immunogen LGWDGKPIPYWLYKLHGLNINYNCEICGNYTYRGPKAFQRHFAEWRHAHGMRCLGIPNTAHFANVTQIEDAVSLWAKLKLQK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PRP9, PRPF9, SAP61, SF3a60
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12874
HTS Code 3002150000
Gene ID 10946
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SF3A3 Antibody 100ul

Anti-SF3A3 Antibody 100ul