HPDL,4-HPPD-L
  • HPDL,4-HPPD-L

Anti-HPDL Antibody 100ul

Ref: AN-HPA031997-100ul
Anti-HPDL

Información del producto

Polyclonal Antibody against Human HPDL, Gene description: 4-hydroxyphenylpyruvate dioxygenase-like, Alternative Gene Names: 4-HPPD-L, GLOXD1, MGC15668, Validated applications: ICC, WB, Uniprot ID: Q96IR7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HPDL
Gene Description 4-hydroxyphenylpyruvate dioxygenase-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence SPGEDPELGLEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAP
Immunogen SPGEDPELGLEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names 4-HPPD-L, GLOXD1, MGC15668
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96IR7
HTS Code 3002150000
Gene ID 84842
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HPDL Antibody 100ul

Anti-HPDL Antibody 100ul