CXCR1,CD181,CDw128a
  • CXCR1,CD181,CDw128a

Anti-CXCR1 Antibody 25ul

Ref: AN-HPA031991-25ul
Anti-CXCR1

Información del producto

Polyclonal Antibody against Human CXCR1, Gene description: chemokine (C-X-C motif) receptor 1, Alternative Gene Names: CD181, CDw128a, CKR-1, CMKAR1, IL8RA, Validated applications: IHC, Uniprot ID: P25024, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CXCR1
Gene Description chemokine (C-X-C motif) receptor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
Immunogen MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD181, CDw128a, CKR-1, CMKAR1, IL8RA
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P25024
HTS Code 3002150000
Gene ID 3577
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CXCR1 Antibody 25ul

Anti-CXCR1 Antibody 25ul