POU3F4,BRN4,DFN3
  • POU3F4,BRN4,DFN3

Anti-POU3F4 Antibody 100ul

Ref: AN-HPA031984-100ul
Anti-POU3F4

Información del producto

Polyclonal Antibody against Human POU3F4, Gene description: POU class 3 homeobox 4, Alternative Gene Names: BRN4, DFN3, DFNX2, OTF9, Validated applications: WB, Uniprot ID: P49335, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name POU3F4
Gene Description POU class 3 homeobox 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH
Immunogen RSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BRN4, DFN3, DFNX2, OTF9
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P49335
HTS Code 3002150000
Gene ID 5456
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-POU3F4 Antibody 100ul

Anti-POU3F4 Antibody 100ul