TXNDC9,APACD
  • TXNDC9,APACD

Anti-TXNDC9 Antibody 25ul

Ref: AN-HPA031845-25ul
Anti-TXNDC9

Información del producto

Polyclonal Antibody against Human TXNDC9, Gene description: thioredoxin domain containing 9, Alternative Gene Names: APACD, Validated applications: IHC, WB, Uniprot ID: O14530, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TXNDC9
Gene Description thioredoxin domain containing 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence TQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
Immunogen TQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APACD
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14530
HTS Code 3002150000
Gene ID 10190
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TXNDC9 Antibody 25ul

Anti-TXNDC9 Antibody 25ul