ZBTB8A,BOZF1
  • ZBTB8A,BOZF1

Anti-ZBTB8A Antibody 100ul

Ref: AN-HPA031770-100ul
Anti-ZBTB8A

Información del producto

Polyclonal Antibody against Human ZBTB8A, Gene description: zinc finger and BTB domain containing 8A, Alternative Gene Names: BOZF1, FLJ90065, ZBTB8, ZNF916A, Validated applications: ICC, IHC, Uniprot ID: Q96BR9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZBTB8A
Gene Description zinc finger and BTB domain containing 8A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence KCKRHVTDLTGQVVQEGTRRYRLCNECLAEFGIDSLPIDLEAEQHLMSPSDGDKDSRWHLSEDENRSYVEIVEDGSGDLVIQQ
Immunogen KCKRHVTDLTGQVVQEGTRRYRLCNECLAEFGIDSLPIDLEAEQHLMSPSDGDKDSRWHLSEDENRSYVEIVEDGSGDLVIQQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BOZF1, FLJ90065, ZBTB8, ZNF916A
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96BR9
HTS Code 3002150000
Gene ID 653121
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZBTB8A Antibody 100ul

Anti-ZBTB8A Antibody 100ul