SON,BASS1,C21orf50
  • SON,BASS1,C21orf50

Anti-SON Antibody 100ul

Ref: AN-HPA031756-100ul
Anti-SON

Información del producto

Polyclonal Antibody against Human SON, Gene description: SON DNA binding protein, Alternative Gene Names: BASS1, C21orf50, DBP-5, FLJ21099, FLJ33914, KIAA1019, NREBP, Validated applications: ICC, Uniprot ID: P18583, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SON
Gene Description SON DNA binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence PVAKVLEPSETLVVSSETPTEVYPEPSTSTTMDFPESSAIEALRLPEQPVDVPSEIADSSMTRPQELPELPKTTALE
Immunogen PVAKVLEPSETLVVSSETPTEVYPEPSTSTTMDFPESSAIEALRLPEQPVDVPSEIADSSMTRPQELPELPKTTALE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BASS1, C21orf50, DBP-5, FLJ21099, FLJ33914, KIAA1019, NREBP
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P18583
HTS Code 3002150000
Gene ID 6651
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SON Antibody 100ul

Anti-SON Antibody 100ul