PERM1,C1orf170
  • PERM1,C1orf170

Anti-PERM1 Antibody 100ul

Ref: AN-HPA031711-100ul
Anti-PERM1

Información del producto

Polyclonal Antibody against Human PERM1, Gene description: PPARGC1 and ESRR induced regulator, muscle 1, Alternative Gene Names: C1orf170, MGC13275, Perm1, RP11-54O7.8, Validated applications: IHC, Uniprot ID: Q5SV97, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PERM1
Gene Description PPARGC1 and ESRR induced regulator, muscle 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence ILKHLPRPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRRRGSPEPLPRADPVPAPIPGDPVPISIPE
Immunogen ILKHLPRPPPSAVTRVGPGSSFAVTLPEAYEFFFCDTIEENEEAEAAAAGQDPAGVQWPDMCEFFFPDVGAQRSRRRGSPEPLPRADPVPAPIPGDPVPISIPE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf170, MGC13275, Perm1, RP11-54O7.8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5SV97
HTS Code 3002150000
Gene ID 84808
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PERM1 Antibody 100ul

Anti-PERM1 Antibody 100ul