GPR107,FLJ20998
  • GPR107,FLJ20998

Anti-GPR107 Antibody 25ul

Ref: AN-HPA031704-25ul
Anti-GPR107

Información del producto

Polyclonal Antibody against Human GPR107, Gene description: G protein-coupled receptor 107, Alternative Gene Names: FLJ20998, KIAA1624, LUSTR1, RP11-88G17, Validated applications: IHC, Uniprot ID: Q5VW38, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GPR107
Gene Description G protein-coupled receptor 107
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV
Immunogen KFRPASDNPYLQLSQEEEDLEMESVVTTSGVMESMKKVKKVTNGSVEPQGEWEGSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20998, KIAA1624, LUSTR1, RP11-88G17
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5VW38
HTS Code 3002150000
Gene ID 57720
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GPR107 Antibody 25ul

Anti-GPR107 Antibody 25ul