RSPH9,C6orf206
  • RSPH9,C6orf206

Anti-RSPH9 Antibody 25ul

Ref: AN-HPA031703-25ul
Anti-RSPH9

Información del producto

Polyclonal Antibody against Human RSPH9, Gene description: radial spoke head 9 homolog (Chlamydomonas), Alternative Gene Names: C6orf206, CILD12, FLJ30845, MRPS18AL1, Validated applications: IHC, Uniprot ID: Q9H1X1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RSPH9
Gene Description radial spoke head 9 homolog (Chlamydomonas)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSY
Immunogen SSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf206, CILD12, FLJ30845, MRPS18AL1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H1X1
HTS Code 3002150000
Gene ID 221421
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RSPH9 Antibody 25ul

Anti-RSPH9 Antibody 25ul