CD40,Bp50,p50
  • CD40,Bp50,p50

Anti-CD40 Antibody 100ul

Ref: AN-HPA031568-100ul
Anti-CD40

Información del producto

Polyclonal Antibody against Human CD40, Gene description: CD40 molecule, TNF receptor superfamily member 5, Alternative Gene Names: Bp50, p50, TNFRSF5, Validated applications: IHC, WB, Uniprot ID: P25942, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CD40
Gene Description CD40 molecule, TNF receptor superfamily member 5
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD
Immunogen EGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQD
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Bp50, p50, TNFRSF5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P25942
HTS Code 3002150000
Gene ID 958
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CD40 Antibody 100ul

Anti-CD40 Antibody 100ul