POLR1A
  • POLR1A

Anti-POLR1A Antibody 100ul

Ref: AN-HPA031513-100ul
Anti-POLR1A

Información del producto

Polyclonal Antibody against Human POLR1A, Gene description: polymerase (RNA) I polypeptide A, 194kDa, Alternative Gene Names: DKFZP586M0122, FLJ21915, RPA1, RPO1-4, Validated applications: IHC, Uniprot ID: O95602, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name POLR1A
Gene Description polymerase (RNA) I polypeptide A, 194kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHPNTLLRRGAFLSYSQKIQEAVKALKLESENRNGRSPGTQEMLRMWYELDEESRRKYQ
Immunogen SNYEVIMKSQHLHEVLSRADPKKALHHFRAIKKWQSKHPNTLLRRGAFLSYSQKIQEAVKALKLESENRNGRSPGTQEMLRMWYELDEESRRKYQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP586M0122, FLJ21915, RPA1, RPO1-4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95602
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-POLR1A Antibody 100ul

Anti-POLR1A Antibody 100ul