ERLEC1,C2orf30
  • ERLEC1,C2orf30

Anti-ERLEC1 Antibody 100ul

Ref: AN-HPA031501-100ul
Anti-ERLEC1

Información del producto

Polyclonal Antibody against Human ERLEC1, Gene description: endoplasmic reticulum lectin 1, Alternative Gene Names: C2orf30, CL25084, ERLECTIN, XTP3-B, XTP3TPB, Validated applications: IHC, WB, Uniprot ID: Q96DZ1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ERLEC1
Gene Description endoplasmic reticulum lectin 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, WB
Sequence PFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYE
Immunogen PFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTKEERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C2orf30, CL25084, ERLECTIN, XTP3-B, XTP3TPB
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96DZ1
HTS Code 3002150000
Gene ID 27248
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ERLEC1 Antibody 100ul

Anti-ERLEC1 Antibody 100ul