BSDC1,FLJ10276
  • BSDC1,FLJ10276

Anti-BSDC1 Antibody 25ul

Ref: AN-HPA031358-25ul
Anti-BSDC1

Información del producto

Polyclonal Antibody against Human BSDC1, Gene description: BSD domain containing 1, Alternative Gene Names: FLJ10276, RP4-811H24.7, Validated applications: ICC, IHC, WB, Uniprot ID: Q9NW68, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BSDC1
Gene Description BSD domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC, WB
Sequence DLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGEVSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCL
Immunogen DLRVFELNSDSGKSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGEVSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10276, RP4-811H24.7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NW68
HTS Code 3002150000
Gene ID 55108
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BSDC1 Antibody 25ul

Anti-BSDC1 Antibody 25ul