CLCN4,ClC-4,CLC4
  • CLCN4,ClC-4,CLC4

Anti-CLCN4 Antibody 25ul

Ref: AN-HPA031313-25ul
Anti-CLCN4

Información del producto

Polyclonal Antibody against Human CLCN4, Gene description: chloride channel, voltage-sensitive 4, Alternative Gene Names: ClC-4, CLC4, Validated applications: IHC, Uniprot ID: P51793, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CLCN4
Gene Description chloride channel, voltage-sensitive 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS
Immunogen VVSRDSERLIGFAQRRELILAIKNARQRQEGIVSNSIMYFTEEPPELPANSPHPLKLRRILNLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ClC-4, CLC4
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P51793
HTS Code 3002150000
Gene ID 1183
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CLCN4 Antibody 25ul

Anti-CLCN4 Antibody 25ul