TTC27,FLJ20272
  • TTC27,FLJ20272

Anti-TTC27 Antibody 25ul

Ref: AN-HPA031246-25ul
Anti-TTC27

Información del producto

Polyclonal Antibody against Human TTC27, Gene description: tetratricopeptide repeat domain 27, Alternative Gene Names: FLJ20272, Validated applications: IHC, Uniprot ID: Q6P3X3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TTC27
Gene Description tetratricopeptide repeat domain 27
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IWENYILTSTDVGEFSEAIKAYHRLLDLRDKYKDVQVLKILVRAVIDGMTDRSGDVATGLKGKLQELFGRVTSRVTNDGEIWRLYAHVYGNGQ
Immunogen IWENYILTSTDVGEFSEAIKAYHRLLDLRDKYKDVQVLKILVRAVIDGMTDRSGDVATGLKGKLQELFGRVTSRVTNDGEIWRLYAHVYGNGQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ20272
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P3X3
HTS Code 3002150000
Gene ID 55622
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TTC27 Antibody 25ul

Anti-TTC27 Antibody 25ul