MCL1,BCL2L3,Mcl-1
  • MCL1,BCL2L3,Mcl-1

Anti-MCL1 Antibody 25ul

Ref: AN-HPA031125-25ul
Anti-MCL1

Información del producto

Polyclonal Antibody against Human MCL1, Gene description: myeloid cell leukemia 1, Alternative Gene Names: BCL2L3, Mcl-1, Validated applications: IHC, Uniprot ID: Q07820, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name MCL1
Gene Description myeloid cell leukemia 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
Immunogen MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BCL2L3, Mcl-1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q07820
HTS Code 3002150000
Gene ID 4170
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-MCL1 Antibody 25ul

Anti-MCL1 Antibody 25ul